Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colicin-A immunity protein (cai)

This Recombinant Colicin-A immunity protein (cai) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Colicin-A immunity protein, Microcin-A immunity protein

UniProt

P05701

Expression Region

1-178

Origin

Citrobacter freundii

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNEHSIDTDNRKANNALYLFIIIGLIPLLCIFVVYYKTPDALLLRKIATSTENLPSITS SYNPLMTKVMDIYCKTAPFLALILYILTFKIRKLINNTDRNTVLRSCLLSPLVYAAIVYL FCFRNFELTTAGRPVRLMATNDATLLLFYIGLYSIIFFTTYITLFTPVTAFKLLKKRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHCYL2 (NM_001130720) Human Over-expression Lysate
LY427264 100 µg

AHCYL2 (NM_001130720) Human Over-expression Lysate

Sign In for Pricing
View Details
WNT3A Polyclonal Antibody
E-AB-14872-01 20 µL

WNT3A Polyclonal Antibody

Sign In for Pricing
View Details
WNT3A Polyclonal Antibody
E-AB-14872-02 60 µL

WNT3A Polyclonal Antibody

Sign In for Pricing
View Details
WNT3A Polyclonal Antibody
E-AB-14872-03 120 µL

WNT3A Polyclonal Antibody

Sign In for Pricing
View Details
WNT3A Polyclonal Antibody
E-AB-14872-04 200 µL

WNT3A Polyclonal Antibody

Sign In for Pricing
View Details
IRS1 pSer639 Rabbit Polyclonal Antibody
AP02489PU-N 100 µL

IRS1 pSer639 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details