Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yozB (yozB)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yozB (yozB) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yozB

UniProt

O31845

Expression Region

1-178

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQTENKPKNYTGIVLTLTVLINGLIAVLFFMPKLDQFSHANIHILPMLNAIFNSFTFIF LLAALIMIKQKNIKAHKRFILAAFTTTLLFLICYVTYHSIAENTLYGGEGIMRPIYFFIL ITHICLSAIIVPLALFTLIRGFSMQVERHKKIARWTMPLWLYVSLTGVIVYLMISPYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKC Mouse Monoclonal Antibody [Clone ID: HP6053 + L1C1]
AM50289PU-T 20 µg

IGKC Mouse Monoclonal Antibody [Clone ID: HP6053 + L1C1]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB508651 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
1H,1aH,6H,6aH-cyclopropa[a]indene-1-carboxylic acid
TRC-H955433-5MG 5 mg

1H,1aH,6H,6aH-cyclopropa[a]indene-1-carboxylic acid

Sign In for Pricing
View Details
DEFB131A Human Gene Knockout Kit (CRISPR)
KN418014 1 Kit

DEFB131A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lambda Light Chain Recombinant Mouse Monoclonal Antibody [A8G3-R]
HA601267 100 µL

Lambda Light Chain Recombinant Mouse Monoclonal Antibody [A8G3-R]

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS705285 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details