Recombinant Chara vulgaris NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)
Selected Variant
GTR19095196-01
Size: 20 µg
This Recombinant Chara vulgaris NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) spans the amino acid sequence from region 1-178.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 6, NADH-plastoquinone oxidoreductase subunit 6
UniProt
Q1ACE6
Expression Region
1-178
Origin
Chara vulgaris (Common stonewort)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDFLNMSYQLIVAYLIQLGIYIGALAVIFFNNIVYAAISLALVLSLIALLYLFFDADFLA VTQILIYVGAINVLILFAIMLISLPKSSTFIFYFTKKSQISAFACISLFVLLVKIILQTP WSTQSSYILLNENNKLDQIGIYLLSNFLLPFELISLLLLIALIGAVSIARYQNTEETE
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EK1128 96 Well With Removable Strips
Mouse CCL12/MCP5 ELISA Kit PicoKine®
Sign In for Pricing
View Details 
PB10059-carrier-free 100 µg/Vial
Anti-EpCAM Antibody Picoband® (Carrier-free Conjugate)
Sign In for Pricing
View Details 
BNC472782-100 1x 100 µL
Calbindin 1 (CALB1) (CALB1/2782), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC043381-100 1x 100 µL
CD262 / DR5 (DR5/3381), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 