Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Disulfide bond formation protein B (dsbB)

This Recombinant Pasteurella multocida Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q9L6B3

Expression Region

1-178

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSFFKTLSTKRSAWFLLFSSALLLEAIALYFQHGMGLAPCVMCIYERVAILGIAFSGLL GLLYPSSMLLRLVALLIGLSSAIKGLMISITHLDLQLYPAPWKQCSAVAEFPETLPLDQW FPALFLPSGSCSEVTWQFLGFSMVQWIVVIFALYTLLLALIFISQVKRLKPKQRRLFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL27A (NM_000990) Human Over-expression Lysate
LC400357 20 µg

RPL27A (NM_000990) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560334 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
CTSO Antibody
KC-27150-01 50 μL

CTSO Antibody

Sign In for Pricing
View Details
CTSO Antibody
KC-27150-02 100 µL

CTSO Antibody

Sign In for Pricing
View Details
CTSO Antibody
KC-27150-03 1 mL

CTSO Antibody

Sign In for Pricing
View Details
53BP1 Antibody
KC-8152-01 50 μL

53BP1 Antibody

Sign In for Pricing
View Details