Recombinant Citrobacter koseri Probable intracellular septation protein A (CKO_01331)
This Recombinant Citrobacter koseri Probable intracellular septation protein A (CKO_01331) spans the amino acid sequence from region 1-179.
Product Specifications
Product Name Alternative
Probable intracellular septation protein A
UniProt
A8AG55
Expression Region
1-179
Origin
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKVEKMALITFVLVAV FGGLTIFFHNDEFIKWKVTVIYGLFAGALLISQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA725215 100 µL
Human S100A12 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
NUN-C52Hs-100ug 100 µg
SARS-CoV-2 Nucleocapsid protein (D63G, R203M, D377Y), His Tag
Sign In for Pricing
View Details 
BNC043015-100 1x 100 µL
MerTK (Innate Immune Checkpoint) (MERTK/3015), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
