Recombinant Salmonella enteritidis PT4 Probable intracellular septation protein A (yciB)
This Recombinant Salmonella enteritidis PT4 Probable intracellular septation protein A (yciB) spans the amino acid sequence from region 1-179.
Product Specifications
Product Name Alternative
Probable intracellular septation protein A
UniProt
B5R3N5
Expression Region
1-179
Origin
Salmonella enteritidis PT4 (strain P125109)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550809-500 1x 500 µL
Cyclin D1 (CCND1/809), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details