Recombinant Variovorax paradoxus Probable intracellular septation protein A (Vapar_2937)
This Recombinant Variovorax paradoxus Probable intracellular septation protein A (Vapar_2937) spans the amino acid sequence from region 1-179.
Product Specifications
Product Name Alternative
Probable intracellular septation protein A
UniProt
C5CNT0
Expression Region
1-179
Origin
Variovorax paradoxus (strain S110)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKLILDFFPILLFFGAYKLADIYTATGVLMAATVLQMGIIYAMERKLQAMQKATLVLILL FGTLTLVLHDDRFIKWKPTVLYGAMAIALAVALWALKKNFLKMLLGSQLQLPDRIWGRLN VAWIGYCLFMAAINGYVAAYFTTEAWVNFKLWGYVFPIVFLVAQGLYISPHLKNDEPSV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680012-500 1x 500 µL
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940158-500 1x 500 µL
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 