Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yndM (yndM)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yndM (yndM) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yndM

UniProt

O31816

Expression Region

1-179

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIMNGFELHYLSFVYAQEFSSKNNNLGGQMKHIIALASKIAFTLALLYVILDRVYHASF LSVMFIALFLGFVSYLSGDMLVLPRTNNITASLADFGLSFVILWVFVLTQTRNDFSPFGA ALLSAACLTVFEYFFHRYLLKNVLDENFRNELSARDNTLQYQTEAADELFPETKEKHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS505281 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
CF®790-Dextran 10,000 MW, Anionic and Fixable
#80121 1x 1 mg

CF®790-Dextran 10,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
Human ZDHHC19 activation kit by CRISPRa
GA115147 1 Kit

Human ZDHHC19 activation kit by CRISPRa

Sign In for Pricing
View Details
2’,3’-Isopropylidene Adenosine-13C5
TRC-I824677-2.5MG 2.5 mg

2’,3’-Isopropylidene Adenosine-13C5

Sign In for Pricing
View Details
Recombinant Human LACTB2 Protein (GST Tag)
PKSH033268-01 10 µg

Recombinant Human LACTB2 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human LACTB2 Protein (GST Tag)
PKSH033268-02 50 µg

Recombinant Human LACTB2 Protein (GST Tag)

Sign In for Pricing
View Details