Recombinant Bacillus subtilis Uncharacterized membrane protein yndM (yndM)
This Recombinant Bacillus subtilis Uncharacterized membrane protein yndM (yndM) spans the amino acid sequence from region 1-179.
Product Specifications
Product Name Alternative
Uncharacterized membrane protein yndM
UniProt
O31816
Expression Region
1-179
Origin
Bacillus subtilis (strain 168)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTIMNGFELHYLSFVYAQEFSSKNNNLGGQMKHIIALASKIAFTLALLYVILDRVYHASF LSVMFIALFLGFVSYLSGDMLVLPRTNNITASLADFGLSFVILWVFVLTQTRNDFSPFGA ALLSAACLTVFEYFFHRYLLKNVLDENFRNELSARDNTLQYQTEAADELFPETKEKHKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![EDANS sodium salt [5- ((2-Aminoethyl) aminonaphthalene-1-sulfonic acid, sodium salt] *CAS 100900-07-0*](https://cdn.genprice.uk/products/271/7358925/imageurl/615-aat.webp)
615-AAT 1 g
EDANS sodium salt [5- ((2-Aminoethyl) aminonaphthalene-1-sulfonic acid, sodium salt] *CAS 100900-07-0*
Sign In for Pricing
View Details 
MT07F4-CON A/W 10x 96 Well Plates
Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
Sign In for Pricing
View Details 
