Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquifex aeolicus Uncharacterized protein aq_757 (aq_757)

This Recombinant Aquifex aeolicus Uncharacterized protein aq_757 (aq_757) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Uncharacterized protein aq_757

UniProt

O66959

Expression Region

1-179

Origin

Aquifex aeolicus (strain VF5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKAESVSQWILVILFATLLFFAFTGIFVSTLLVVLTPEGFAFLLGFLGALVFANKLLFGY GSFVITAEAFLTNKEIDRRELAKKTNEPVERTENLSIPALLALWLAGLDYYRYAYYGIFT LMLIIMLLSKFDLLGALTIGNYFEGAFWGAAVITLFVFALEITANYLMARINEEVSLNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF405S conjugate, 0.1mg/mL
BNC041815-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), CF594 conjugate, 0.1mg/mL
BNC941932-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF488A conjugate, 0.1mg/mL
BNC881424-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details