Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Probable intracellular septation protein A (yciB)

This Recombinant Salmonella paratyphi A Probable intracellular septation protein A (yciB) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

Q5PD20

Expression Region

1-179

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), 1mg/mL
BNUM0008-50 1x 50 µL

MAGE A1 (MA454), 1mg/mL

Sign In for Pricing
View Details
MyoD1 (5.8A + MYD712), CF405S conjugate, 0.1mg/mL
BNC040713-100 1x 100 µL

MyoD1 (5.8A + MYD712), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (M3.1), CF640R conjugate, 0.1mg/mL
BNC400990-100 1x 100 µL

Mucin 3 (M3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF568 conjugate, 0.1mg/mL
BNC682227-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF568 conjugate, 0.1mg/mL
BNC682984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF488A conjugate, 0.1mg/mL
BNC882475-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details