Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Filament integrity protein fraC (fraC)

This Recombinant Nostoc sp. Filament integrity protein fraC (fraC) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Filament integrity protein fraC

UniProt

P46078

Expression Region

1-179

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEDLTIPRIWPIGAILFNLLFLLIAIPIEGYIYHRRLNFDKKTSIFYAIAVNSFSGVIG WVIFFFVEPVLPVPIKAELINYIFFNIFRSTNTQGVLIFTTFIIFFSTFLMKFFLLRLFV FTLSEDIGKKQEEPQPFYRQKVRFISRIRLQDTNLVTTTLIANSLSYTAITIILLIRNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-500 1x 500 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD15 / FUT4 (Reed-Sternberg Cell Marker) (FUT4/1478R), CF488A conjugate, 0.1mg/mL
BNC881478-500 1x 500 µL

CD15 / FUT4 (Reed-Sternberg Cell Marker) (FUT4/1478R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SUMO1/1188), CF740 conjugate, 0.1mg/mL
BNC741188-100 1x 100 µL

SUMO-1 (SUMO1/1188), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details