Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit D (1A) dopamine receptor (DRD1)

This Recombinant Rabbit D (1A) dopamine receptor (DRD1) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

D (1A) dopamine receptor, Dopamine D1 receptor

UniProt

O02664

Expression Region

1-180

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NTLLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIW VAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILIGVAWTLSVLISFIPV QLSWHKAKPTSPPDGNATSLDETVDNCDSSLSRTYSISSSLVNFYNPVAIMXVTYTRIHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PapJ Antibody
orb818567 2 mg

PapJ Antibody

Sign In for Pricing
View Details
HOP Protein
orb1714244-01 50 µg

HOP Protein

Sign In for Pricing
View Details
HOP Protein
orb1714244-02 100 µg

HOP Protein

Sign In for Pricing
View Details
Cytochrome b5 Microplate Assay Kit
E51K1034 100 Assays

Cytochrome b5 Microplate Assay Kit

Sign In for Pricing
View Details
RB1CC1 antibody - C-terminal region
MBS3209949-01 0.1 mL

RB1CC1 antibody - C-terminal region

Sign In for Pricing
View Details
RB1CC1 antibody - C-terminal region
MBS3209949-02 5x 0.1 mL

RB1CC1 antibody - C-terminal region

Sign In for Pricing
View Details