Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella pealeana Probable intracellular septation protein A (Spea_1640)

This Recombinant Shewanella pealeana Probable intracellular septation protein A (Spea_1640) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

A8H328

Expression Region

1-181

Origin

Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQLLDFLPLVIFFAVYKFFDIYIASGALIAATALQLVISYLLYKKLEKMHLITFVMVTV FGSLTLILHDDSFIKWKVTIVYALFAIALGVSQIMNKPLLKSMLGKELIVEDKIWARVTW YWVSFFVVCGLVNIYVAFSLSQETWVNFKVFGLTALTLINTVLTVVYLFKNMSEEDRKEL K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details