What is the catalog number for Recombinant Mouse Transmembrane protein 47 (Tmem47)?

The catalog number for Recombinant Mouse Transmembrane protein 47 (Tmem47) is orb2919509.

What sizes are available for Recombinant Mouse Transmembrane protein 47 (Tmem47)?

Recombinant Mouse Transmembrane protein 47 (Tmem47) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Mouse Transmembrane protein 47 (Tmem47) come in?

Recombinant Mouse Transmembrane protein 47 (Tmem47) is available in 2 different pack sizes.

Recombinant Mouse Transmembrane protein 47 (Tmem47)

Q: Is Recombinant Mouse Transmembrane protein 47 (Tmem47) in stock?

Recombinant Mouse Transmembrane protein 47 (Tmem47) is currently made to order / not held in immediate stock. Contact us for lead time.

This Recombinant Mouse Transmembrane protein 47 (Tmem47) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

Transmembrane protein 47, Transmembrane 4 superfamily member 10

UniProt

Q9JJG6

Expression Region

1-181

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRK PANLDIWHCESTLGSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLF AAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDY Y