Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 (Nkain3)

This Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 (Nkain3) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3, Na (+) /K (+) -transporting ATPase subunit beta-1-interacting protein 3, Protein FAM77D

UniProt

Q3URJ8

Expression Region

1-181

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGCCTGRCSLVCLCALQLLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPR YIMVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLP PSAHGMMDDYTYVSVTGCVVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTCRN K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-100 1x 100 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details