Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mpv17-like protein (T18D3.9)

This Recombinant Mpv17-like protein (T18D3.9) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

Mpv17-like protein

UniProt

Q7YWV6

Expression Region

1-181

Origin

Caenorhabditis elegans

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIILFIRRRLATNPLSTQMCIAGTISGSGDCLAQYLSHNQEWDRWRTARFSFLSSCFMA PSLFIWFRLLEKVKGNNKSLLLVKKLCIDQLCFSPCFNAAILFNLRLLQHQSAEKSWDLL KEDWFNIYATSLKVWPFVQVVNLCFVPLNYRVILNQVVAFFWNCYLSYITQKPIDHIEQF Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RABL5 Antibody
8C18134-AAT 50 µg

RABL5 Antibody

Sign In for Pricing
View Details
Cbfb Mouse Gene Knockout Kit (CRISPR)
KN502594 1 Kit

Cbfb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome p450 2J2 (CYP2J2) Rabbit Polyclonal Antibody
AP14098PU-N 400 µL

Cytochrome p450 2J2 (CYP2J2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCML2 Mouse Monoclonal Antibody [Clone ID: OTI1E1]
CF807779 100 µg

SCML2 Mouse Monoclonal Antibody [Clone ID: OTI1E1]

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), Biotin conjugate, 0.1mg/mL
BNCB2618-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF640R conjugate, 0.1mg/mL
BNC400730-500 1x 500 µL

HSP60 (GROEL/730), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details