Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. cremoris Biotin transporter BioY2 (bioY2)

This Recombinant Lactococcus lactis subsp. cremoris Biotin transporter BioY2 (bioY2) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

Biotin transporter BioY2, Biotin ECF transporter S component BioY2

UniProt

A2RI45

Expression Region

1-182

Origin

Lactococcus lactis subsp. cremoris (strain MG1363)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNTKLYSLTLIALGAAIIAVLSPLAIPIGIVPVTLQTLAVGLVATVLKARETFFAILLY LLLGFIGIPVFTGGTSGIAVLFGPTGGFLLAFLVMGTLISWGLHQIKYKTIPAFIINIVG HLLMLVIGTLWLKFFTQVDWSLALKLGFTPFVFVEIIKAILVTIFGLALIRALSHTNKYF TN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO7 (NM_001033024) Human Over-expression Lysate
LC422341 20 µg

FBXO7 (NM_001033024) Human Over-expression Lysate

Sign In for Pricing
View Details
ZC3HAV1 Polyclonal Antibody
E-AB-19553-01 20 µL

ZC3HAV1 Polyclonal Antibody

Sign In for Pricing
View Details
ZC3HAV1 Polyclonal Antibody
E-AB-19553-02 60 µL

ZC3HAV1 Polyclonal Antibody

Sign In for Pricing
View Details
ZC3HAV1 Polyclonal Antibody
E-AB-19553-03 120 µL

ZC3HAV1 Polyclonal Antibody

Sign In for Pricing
View Details
ZC3HAV1 Polyclonal Antibody
E-AB-19553-04 200 µL

ZC3HAV1 Polyclonal Antibody

Sign In for Pricing
View Details
IRF7 Rabbit Polyclonal Antibody
AP07320PU-N 50 µg

IRF7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details