Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bifidobacterium longum subsp. infantis Lipoprotein signal peptidase (lspA)

This Recombinant Bifidobacterium longum subsp. infantis Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II

UniProt

B7GQ27

Expression Region

1-182

Origin

Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNQQGRLRTRVAVFACVAAAALIVDQLTKAWAMAALSNGQTIRVIPGLLSFTLVRNPGA SLGMGSGATWVISLLAVVACVALAVAGVRTISMKWSVALSFAFAGALGNLIDRVMYADGF LNGKVVDFLNYGWSVGNVADIYLVVAGVVLVILILMGEPFSHKDLIEQSDESLQSEPEAD AK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-100 1x 100 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details