Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)

This Recombinant Sodalis glossinidius CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, EC= 2.7.8.5, Phosphatidylglycerophosphate synthase, PGP synthase

UniProt

Q2NTS8

Expression Region

1-182

Origin

Sodalis glossinidius (strain morsitans)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLNIPTWLTLFRVVMIPFFVLAFYLPFKWAPLCCALIFVLAAVTDWFDGFLARRWKQTT RFGAFLDPVADKVMVAMALVLVAEHFHSWWITLPAATMIAREIIISALREWMAEIGKRSS VAVSWIGKVKTTAQMLALVTLLWRPDDIVSGIGIAALYVAAVLTFWSMFQYLYAARHDLF EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details