Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0397 protein BT9727_2423 (BT9727_2423)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0397 protein BT9727_2423 (BT9727_2423) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

UPF0397 protein BT9727_2423

UniProt

Q6HI77

Expression Region

1-182

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRLSTKLVVAIGIGSALYGILGLWGFSIAPNTFIKPALAILTVFGALFGPVAGLLIGLI GHTVTDTIAGWGIWWGWVISSGIIGFTMGFIQKRVGFSVKNGTYNKGDISYLAITGLIGI VIAIIFAGAFDIIVMGEPFDKIVIQVLGATIADVIVFLVLGLPITIGLAKSNKKHTHLKI EK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APBB2 Human qPCR Primer Pair (NM_173075)
HP218269 200 Reactions

APBB2 Human qPCR Primer Pair (NM_173075)

Sign In for Pricing
View Details
Ceacam12 ORF Vector (Mouse) (pORF)
ORF041101 1.0 µg DNA

Ceacam12 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Dynorphin B (1-13) (TFA)
MBS5763632 Inquire

Dynorphin B (1-13) (TFA)

Sign In for Pricing
View Details
Mab21l3 ORF Vector (Mouse) (pORF)
ORF049625 1.0 µg DNA

Mab21l3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Simport, EasyDip Staining Rack
1212165 1 Unit

Simport, EasyDip Staining Rack

Sign In for Pricing
View Details
DUSP5 sgRNA CRISPR Lentivector set (Human)
K0638201 3x 1.0 µg

DUSP5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details