Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0397 protein BT9727_2423 (BT9727_2423)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0397 protein BT9727_2423 (BT9727_2423) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

UPF0397 protein BT9727_2423

UniProt

Q6HI77

Expression Region

1-182

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRLSTKLVVAIGIGSALYGILGLWGFSIAPNTFIKPALAILTVFGALFGPVAGLLIGLI GHTVTDTIAGWGIWWGWVISSGIIGFTMGFIQKRVGFSVKNGTYNKGDISYLAITGLIGI VIAIIFAGAFDIIVMGEPFDKIVIQVLGATIADVIVFLVLGLPITIGLAKSNKKHTHLKI EK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acsl4 Rabbit Polyclonal Antibody (Biotin)
orb2112634 100 µL

Acsl4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LRRC36 Human Over-expression Lysate
orb1359962 20 µg

LRRC36 Human Over-expression Lysate

Sign In for Pricing
View Details
Hsd17b4 ORF Vector (Mouse) (pORF)
ORF047500 1.0 µg DNA

Hsd17b4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Klhl21 Mouse shRNA Plasmid (Locus ID 242785)
TR507388 1 Kit

Klhl21 Mouse shRNA Plasmid (Locus ID 242785)

Sign In for Pricing
View Details
Glutaredoxin 3 (GLRX3) Recombinant, Human
154796-01 10 µg

Glutaredoxin 3 (GLRX3) Recombinant, Human

Sign In for Pricing
View Details
Glutaredoxin 3 (GLRX3) Recombinant, Human
154796-02 50 µg

Glutaredoxin 3 (GLRX3) Recombinant, Human

Sign In for Pricing
View Details