Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis UPF0397 protein ydcD (ydcD)

This Recombinant Lactococcus lactis subsp. lactis UPF0397 protein ydcD (ydcD) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

UPF0397 protein ydcD

UniProt

Q9CIN2

Expression Region

1-182

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNNSVKIVVATGIGAALFVIIGWLINIPTPIPNTSIQLQYAVLALFSALFGPLAGFLIG FIGHALKDSFLYGAPWWTWVLGSGLIGLFLAFGVKRETLTQGIFGNKEIIRFNIVQFLAN VVVWGIIAPIGDVLVYSEPANKVFTQGIVAGLVNALTIAVAGTLLLKLYAATRTKSGSLD KE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTau412 Antibody
KC-43717-01 50 μL

PTau412 Antibody

Sign In for Pricing
View Details
PTau412 Antibody
KC-43717-02 100 µL

PTau412 Antibody

Sign In for Pricing
View Details
PTau412 Antibody
KC-43717-03 1 mL

PTau412 Antibody

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF647 conjugate, 0.1mg/mL
BNC472083-500 1x 500 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Thyroid Peroxidase (TPO) activation kit by CRISPRa
GA104957 1 Kit

Human Thyroid Peroxidase (TPO) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561559 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details