Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Plasmolipin (PLLP)

This Recombinant Bovine Plasmolipin (PLLP) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

Plasmolipin, Plasma membrane proteolipid

UniProt

A6H7B0

Expression Region

1-182

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEFPSKVNTRTSSPAQGGGAVVSTLSPDLGFVRSSLGALMLLQLVLGLLVWALIADTPY HLYPSYGWVMFVAVFLWLVTIIFFVLYLFQLHMKLYMVPWPLVLMVFNVGATVLYITAFI TCSASVELTSLKGSQPYNQRAAASFFSCLVMIAYGVSAFLSFQAWRGVGSNAATSQMAGG YA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOL3 (NM_145642) Human Untagged Clone
SC124455 10 µg

APOL3 (NM_145642) Human Untagged Clone

Sign In for Pricing
View Details
COMT Rabbit Polyclonal Antibody
orb156429-01 50 μL

COMT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COMT Rabbit Polyclonal Antibody
orb156429-02 100 µL

COMT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COMT Rabbit Polyclonal Antibody
orb156429-03 200 µL

COMT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OSBPL10 (Oxysterol-binding Protein-related Protein 10, ORP-10, OSBP-related Protein 10, ORP10, OSBP9, FLJ20363) (AP) discontinued
130747-AP 100 µL

OSBPL10 (Oxysterol-binding Protein-related Protein 10, ORP-10, OSBP-related Protein 10, ORP10, OSBP9, FLJ20363) (AP) discontinued

Sign In for Pricing
View Details
5-Methoxypyrazine-2-carbonitrile
NBA78976-01 50 mg

5-Methoxypyrazine-2-carbonitrile

Sign In for Pricing
View Details