Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0163 (AF_0163)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0163 (AF_0163) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0163

UniProt

O30074

Expression Region

1-183

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNISPSPLTDTGKALLRLNLIAIALLWLYPLLTYSQLPETVPTHFGAGGEPDRFGSREEL LILPAVFSIAPAIILIITKLRFTLINRYPQFINLPAFYMNIGKIREERRSYWVNRYFEPV LLLSLILSAGFLGMEYAIFHATLSGELPLLFYIILIFVIAAPLFIFFLYLSMISAQMSRE IGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Stomach
CS506314 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS800413 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
ASB-14
TRC-A790058-2.5G 2.5 g

ASB-14

Sign In for Pricing
View Details
Ccdc40 Mouse Gene Knockout Kit (CRISPR)
KN502714 1 Kit

Ccdc40 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SA 4503 Dihydrochloride
TRC-S139590-50MG 50 mg

SA 4503 Dihydrochloride

Sign In for Pricing
View Details
RASSF1 (NM_007182) Human Over-expression Lysate
LY402099 100 µg

RASSF1 (NM_007182) Human Over-expression Lysate

Sign In for Pricing
View Details