Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0163 (AF_0163)
This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0163 (AF_0163) spans the amino acid sequence from region 1-183.
Product Specifications
Product Name Alternative
Uncharacterized protein AF_0163
UniProt
O30074
Expression Region
1-183
Origin
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNISPSPLTDTGKALLRLNLIAIALLWLYPLLTYSQLPETVPTHFGAGGEPDRFGSREEL LILPAVFSIAPAIILIITKLRFTLINRYPQFINLPAFYMNIGKIREERRSYWVNRYFEPV LLLSLILSAGFLGMEYAIFHATLSGELPLLFYIILIFVIAAPLFIFFLYLSMISAQMSRE IGE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
036708-HRP 200 µL
HOXB8, CT (HOXB8, HOX2D, Homeobox protein Hox-B8, Homeobox protein Hox-2.4, Homeobox protein Hox-2D) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 44811091 4x 500 ng
SNORD119-set siRNA/shRNA/RNAi Lentivector (Human)
Sign In for Pricing
View Details 
DDCR-E008 5 mL
DiagPoly™ Red Colored, Carboxyl Polystyrene Particles, 0.7 μm
Sign In for Pricing
View Details 
M2825-13-ML405 100 µL
MDR Protein (MRP1, Multidrug resistance-associated protein 1, ABCC1, ATP-binding cassette sub-family C member 1, Leukotriene C (4) transporter) (MaxLight 405) discontinued
Sign In for Pricing
View Details