Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1462 (AF_1462)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1462 (AF_1462) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1462

UniProt

O28810

Expression Region

1-183

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLSFTLMVNQFYLTRGFRLIEGKGRMSYIVKAHRLFGYISVGFLLFHPLLEVLPRQFE GSIQPFDAFWKIITTDNSAILLGIAGWAVMLTLAVTSVLRKRLFKNYRKWRTFHGILAVV LITVVGYHVLVLGRHSSLAMKAFYAVLLAGGYVTMIKTYVFDLRREEKWKNRGLKLAEDS SSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MEK7 Antibody
RC-6848-01 50 μL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details
Recombinant MEK7 Antibody
RC-6848-02 100 µL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details
Recombinant MEK7 Antibody
RC-6848-03 1 mL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details
beta Tubulin Recombinant Mouse Monoclonal Antibody [A1-A4-R]
HA601187 100 µL

beta Tubulin Recombinant Mouse Monoclonal Antibody [A1-A4-R]

Sign In for Pricing
View Details
Vertical Autoclave BAVT-403-B
BAVT-403-B 1 Unit

Vertical Autoclave BAVT-403-B

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF740 conjugate, 0.1mg/mL
BNC741869-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details