Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1462 (AF_1462)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1462 (AF_1462) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1462

UniProt

O28810

Expression Region

1-183

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLSFTLMVNQFYLTRGFRLIEGKGRMSYIVKAHRLFGYISVGFLLFHPLLEVLPRQFE GSIQPFDAFWKIITTDNSAILLGIAGWAVMLTLAVTSVLRKRLFKNYRKWRTFHGILAVV LITVVGYHVLVLGRHSSLAMKAFYAVLLAGGYVTMIKTYVFDLRREEKWKNRGLKLAEDS SSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYN (NM_001111097) Human Over-expression Lysate
LC426351 20 µg

LYN (NM_001111097) Human Over-expression Lysate

Sign In for Pricing
View Details
Kir6.2 Rabbit Polyclonal Antibody
ER1803-98 100 µL

Kir6.2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC472562-500 1x 500 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pipette Pump BPIC-202
BPIC-202 1 Unit

Pipette Pump BPIC-202

Sign In for Pricing
View Details
(9R)-9-(2-Pyridinyl)-6-oxaspiro[4.5]decane-9-acetonitrile
TRC-P996960-250MG 250 mg

(9R)-9-(2-Pyridinyl)-6-oxaspiro[4.5]decane-9-acetonitrile

Sign In for Pricing
View Details
Orosomucoid 2 (ORM2) (NM_000608) Human Recombinant Protein
TP323213 20 µg

Orosomucoid 2 (ORM2) (NM_000608) Human Recombinant Protein

Sign In for Pricing
View Details