Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Blochmannia pennsylvanicus CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)

This Recombinant Blochmannia pennsylvanicus CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, EC= 2.7.8.5, Phosphatidylglycerophosphate synthase, PGP synthase

UniProt

Q492P7

Expression Region

1-183

Origin

Blochmannia pennsylvanicus (strain BPEN)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIINIPTYLTLLRVVMVPFFTVMFYLPVRWAPMICTIMFFVAAVTDWFDGFLARRWKQT TSFGKFLDPVADKVMIVAALVLIAEHFHTWWVTLPASIIIIREVIILALREWVAAIGSRN GIGVLWISKIKTFVQMLALTALLWSSDEWIVIIGIVALYVSVLLTFWSMCLYLYIVRYDL FNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR1195), CF568 conjugate, 0.1mg/mL
BNC681195-100 1x 100 µL

EGFR (GFR1195), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details