Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PQ-loop repeat-containing protein 3 (PQLC3)

This Recombinant Human PQ-loop repeat-containing protein 3 (PQLC3) spans the amino acid sequence from region 20-202.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 3

UniProt

Q8N755

Expression Region

20-202

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LKLPQISAVLAARSARGLSLPSLLLELAGFLVFLRYQCYYGYPPLTYLEYPILIAQDVIL LLCIFHFNGNVKQATPYIAVLVSSWFILALQKWIIDLAMNLCTFISAASKFAQLQCLWKT RDSGTVSALTWSLSSYTCATRIITTLMTTNDFTILLRFVIMLALNIWVTVTVLRYRKTAI KAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-Cyp39a1-3xFLAG-CopGFP-Puro Plasmid
PVT70559 2 µg

PLV3-CMV-Cyp39a1-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Human ADAM12 Antibody
orb3152409-01 50 µg

Human ADAM12 Antibody

Sign In for Pricing
View Details
Human ADAM12 Antibody
orb3152409-02 100 µg

Human ADAM12 Antibody

Sign In for Pricing
View Details
Human ADAM12 Antibody
orb3152409-03 1 mg

Human ADAM12 Antibody

Sign In for Pricing
View Details
Anti-Fruit fly Rim Antibody
DZ41621 200 µL/Vial

Anti-Fruit fly Rim Antibody

Sign In for Pricing
View Details
PCDHAC1 Rabbit Polyclonal Antibody (BF680)
orb2408269 100 µL

PCDHAC1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details