Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PQ-loop repeat-containing protein 3 (PQLC3)

This Recombinant Human PQ-loop repeat-containing protein 3 (PQLC3) spans the amino acid sequence from region 20-202.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 3

UniProt

Q8N755

Expression Region

20-202

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LKLPQISAVLAARSARGLSLPSLLLELAGFLVFLRYQCYYGYPPLTYLEYPILIAQDVIL LLCIFHFNGNVKQATPYIAVLVSSWFILALQKWIIDLAMNLCTFISAASKFAQLQCLWKT RDSGTVSALTWSLSSYTCATRIITTLMTTNDFTILLRFVIMLALNIWVTVTVLRYRKTAI KAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A1P31 ORF Vector (Human) (pORF)
ORF018711 1.0 µg DNA

EEF1A1P31 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FZD8 Antibody (HRP)
orb47208-01 50 µg

FZD8 Antibody (HRP)

Sign In for Pricing
View Details
FZD8 Antibody (HRP)
orb47208-02 100 µg

FZD8 Antibody (HRP)

Sign In for Pricing
View Details
Alb Antibody
CSB-PA001561LA01RA-01 50 μL

Alb Antibody

Sign In for Pricing
View Details
Alb Antibody
CSB-PA001561LA01RA-02 100 µL

Alb Antibody

Sign In for Pricing
View Details
Recombinant Collagen I alpha 1 Monoclonal Antibody
MBS2572567-01 0.05 mL

Recombinant Collagen I alpha 1 Monoclonal Antibody

Sign In for Pricing
View Details