Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Vacuolar protein sorting-associated protein 68 (VPS68)

This Recombinant Saccharomyces cerevisiae Vacuolar protein sorting-associated protein 68 (VPS68) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Vacuolar protein sorting-associated protein 68

UniProt

Q12016

Expression Region

1-184

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEADDHVSLFRFPFKIPTFRGIRKGGVYLSGALYALGFWIFLDAVLYSRYSNASDVHVTF IDWIPFLCSTLGTLIVNSIEKNRLLQGALSSDGGAFGSGVGDLDSSMAWQARTVLFFGFA LLAGGLSGSIVVLIIKFLVKDYNTYPTLGMGVNNVLGNVCILLSCVVLWIAQNVEDEYSY SLTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-100 1x 100 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-500 1x 500 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), CF647 conjugate, 0.1mg/mL
BNC470167-100 1x 100 µL

GFAP (GA-5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details