Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0397 protein SAR2767 (SAR2767)

This Recombinant Staphylococcus aureus UPF0397 protein SAR2767 (SAR2767) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

UPF0397 protein SAR2767

UniProt

Q6GDB9

Expression Region

1-184

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM TGLIGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMIYFNTGQII ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS LRKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnj3 Rat shRNA Lentiviral Particle (Locus ID 50599)
TL711418V 500 µL Each

Kcnj3 Rat shRNA Lentiviral Particle (Locus ID 50599)

Sign In for Pricing
View Details
MUC5A Rabbit pAb
E45R23637N 50 ul

MUC5A Rabbit pAb

Sign In for Pricing
View Details
Human DEDD2 knockout cell line
ABC-KH4057 1 Vial

Human DEDD2 knockout cell line

Sign In for Pricing
View Details
VEGF3, NT (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (Azide free) (HRP) discontinued
043740-HRP 200 µL

VEGF3, NT (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Heat Shock Protein Beta 6 Phospho-Ser16 (HSPB6 pS16) Antibody
abx326780-01 50 µg

Heat Shock Protein Beta 6 Phospho-Ser16 (HSPB6 pS16) Antibody

Sign In for Pricing
View Details
Heat Shock Protein Beta 6 Phospho-Ser16 (HSPB6 pS16) Antibody
abx326780-02 100 µg

Heat Shock Protein Beta 6 Phospho-Ser16 (HSPB6 pS16) Antibody

Sign In for Pricing
View Details