Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0397 protein SAR2767 (SAR2767)

This Recombinant Staphylococcus aureus UPF0397 protein SAR2767 (SAR2767) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

UPF0397 protein SAR2767

UniProt

Q6GDB9

Expression Region

1-184

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM TGLIGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMIYFNTGQII ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS LRKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SLC4A4 Protein, N-His-SUMO & C-Strep
HP270012-01 50 µg

Recombinant Human SLC4A4 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Recombinant Human SLC4A4 Protein, N-His-SUMO & C-Strep
HP270012-02 100 µg

Recombinant Human SLC4A4 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Recombinant Human SLC4A4 Protein, N-His-SUMO & C-Strep
HP270012-03 1 mg

Recombinant Human SLC4A4 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Rabbit Polyclonal FBXO34 Antibody [DyLight 594]
NBP3-06221DL594 0.1 mL

Rabbit Polyclonal FBXO34 Antibody [DyLight 594]

Sign In for Pricing
View Details
PLEKHG3, CT (PLEKHG3, KIAA0599, Pleckstrin homology domain-containing family G member 3) (MaxLight 750)
MBS6334881-01 0.1 mL

PLEKHG3, CT (PLEKHG3, KIAA0599, Pleckstrin homology domain-containing family G member 3) (MaxLight 750)

Sign In for Pricing
View Details
PLEKHG3, CT (PLEKHG3, KIAA0599, Pleckstrin homology domain-containing family G member 3) (MaxLight 750)
MBS6334881-02 5x 0.1 mL

PLEKHG3, CT (PLEKHG3, KIAA0599, Pleckstrin homology domain-containing family G member 3) (MaxLight 750)

Sign In for Pricing
View Details