Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1)

This Recombinant Polypterus sp. Cytochrome c oxidase subunit 1 (mt-co1) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 1, EC= 1.9.3.1, Cytochrome c oxidase polypeptide I

UniProt

P29651

Expression Region

1-184

Origin

Polypterus sp. (Bichir)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FWFFGHPEVYILILPGFGMISHIVAYYSGKNEPFGYMGMVWAMMAIGLLGFIVWAHHMYT VGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGAIKWETPMLWALGFIFLFTVGGLT GIILANSSLDIMLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLHSTWTKIHF GVMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WAXY Antibody
orb832642 2 mg

WAXY Antibody

Sign In for Pricing
View Details
Recombinant Rat LAG3 Protein, His (Fc)-Avi-tagged
LAG3-3000R 50 µg

Recombinant Rat LAG3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
ISIS 104838
T64264-01 10 mg

ISIS 104838

Sign In for Pricing
View Details
ISIS 104838
T64264-02 1 g

ISIS 104838

Sign In for Pricing
View Details
ISIS 104838
T64264-03 1 mg

ISIS 104838

Sign In for Pricing
View Details
ISIS 104838
T64264-04 50 mg

ISIS 104838

Sign In for Pricing
View Details