Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha CASP-like protein 2

This Recombinant Marchantia polymorpha CASP-like protein 2 spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

CASP-like protein 2

UniProt

P0DH83

Expression Region

1-184

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTGTTLSASEGDKGFRNGAAPAKSKSHSTIALLRLLAFAATLSAFVTMITNKQKITIG PFTRWSKWHYSDAFMWFVVANCIAFIYLLFAAILGLISHSPMLVKHLVILDLIVSYMLFS AASAATAVAYIGKNGISQPGWTAICGVFERYCHHVAGALVACFLGWLFLTIAVFLGMRRS PAAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SALL3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
42980066 1.0 µg DNA

SALL3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CD3 gamma chain (23-116, His-tag) Human Protein
AR50824PU-N 500 µg

CD3 gamma chain (23-116, His-tag) Human Protein

Sign In for Pricing
View Details
Pristimerin
S9404-1mg 1 mg

Pristimerin

Sign In for Pricing
View Details
IL34 Protein Vector (Mouse) (pPM-C-His)
PV191545 500 ng

IL34 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CAT Knockout MES-OV Polyclonal Cells
ARG42594 1 Million

CAT Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) NPF5.5 Polyclonal Antibody
MBS7182886 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) NPF5.5 Polyclonal Antibody

Sign In for Pricing
View Details