Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha CASP-like protein 2

This Recombinant Marchantia polymorpha CASP-like protein 2 spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

CASP-like protein 2

UniProt

P0DH83

Expression Region

1-184

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTGTTLSASEGDKGFRNGAAPAKSKSHSTIALLRLLAFAATLSAFVTMITNKQKITIG PFTRWSKWHYSDAFMWFVVANCIAFIYLLFAAILGLISHSPMLVKHLVILDLIVSYMLFS AASAATAVAYIGKNGISQPGWTAICGVFERYCHHVAGALVACFLGWLFLTIAVFLGMRRS PAAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 (pY512) Blocking Peptide
CBP1569-01 1 mg

CD54 (pY512) Blocking Peptide

Sign In for Pricing
View Details
CD54 (pY512) Blocking Peptide
CBP1569-02 5 mg

CD54 (pY512) Blocking Peptide

Sign In for Pricing
View Details
RAB3B Peptide
DF14446-BP 1 mg

RAB3B Peptide

Sign In for Pricing
View Details
Mouse Monoclonal alpha-2B Adrenergic R/ADRA2B Antibody (491613) [DyLight 550]
FAB10324L 0.1 mL

Mouse Monoclonal alpha-2B Adrenergic R/ADRA2B Antibody (491613) [DyLight 550]

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)
MBS2164082-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)
MBS2164082-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 8a (CD8a)

Sign In for Pricing
View Details