Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha CASP-like protein 2

This Recombinant Marchantia polymorpha CASP-like protein 2 spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

CASP-like protein 2

UniProt

P0DH83

Expression Region

1-184

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTGTTLSASEGDKGFRNGAAPAKSKSHSTIALLRLLAFAATLSAFVTMITNKQKITIG PFTRWSKWHYSDAFMWFVVANCIAFIYLLFAAILGLISHSPMLVKHLVILDLIVSYMLFS AASAATAVAYIGKNGISQPGWTAICGVFERYCHHVAGALVACFLGWLFLTIAVFLGMRRS PAAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ mmu-miR-5617-5p miRNA Agomir/Antagomir
AM4285 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-5617-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
(2S,4R) -H-L-Pro (4-N3) -OH
HY-151639 1 Each

(2S,4R) -H-L-Pro (4-N3) -OH

Sign In for Pricing
View Details
Mouse Monoclonal PTH Antibody (3H9) [Alexa Fluor 405]
NBP2-54320AF405 100 µL

Mouse Monoclonal PTH Antibody (3H9) [Alexa Fluor 405]

Sign In for Pricing
View Details
Porcine Hpt ELISA Kit
orb440085-01 48 Tests

Porcine Hpt ELISA Kit

Sign In for Pricing
View Details
Porcine Hpt ELISA Kit
orb440085-02 96 Tests

Porcine Hpt ELISA Kit

Sign In for Pricing
View Details
MAP3K4 Rabbit Monoclonal Antibody
E46F1680 40 µL

MAP3K4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details