Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea sitchensis CASP-like protein 8

This Recombinant Picea sitchensis CASP-like protein 8 spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

CASP-like protein 8

UniProt

A9NMM6

Expression Region

1-185

Origin

Picea sitchensis (Sitka spruce) (Pinus sitchensis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTDSNSGHLLQAKRFELLFRVTPLALCIAAMAIMLKNKQSNQYGALHYSDVGGFKYLVY ANGICAIYSILSLLGSVLSTGIDYSWTRAWIMFILDQALTYLILTAGVCGVEIMDLAYQG NEQVSWSRVCVSYGKFCNDARASVLITMAVLVCFMVLSLLSAHRLFSKYEAPIVNNGHHT DFSQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-Deoxy-N-(3-oxo-1-propenyl)adenosine
TRC-D330050-5MG 5 mg

2'-Deoxy-N-(3-oxo-1-propenyl)adenosine

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS705956 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
AKR1A1 (NM_006066) Human Over-expression Lysate
LY401826 100 µg

AKR1A1 (NM_006066) Human Over-expression Lysate

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), 0.2mg/mL
BNUB2220-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/839), 0.2mg/mL

Sign In for Pricing
View Details
FXYD5 Antibody
KC-3369-01 50 μL

FXYD5 Antibody

Sign In for Pricing
View Details
FXYD5 Antibody
KC-3369-02 100 µL

FXYD5 Antibody

Sign In for Pricing
View Details