Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Picea sitchensis CASP-like protein 8

This Recombinant Picea sitchensis CASP-like protein 8 spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

CASP-like protein 8

UniProt

A9NMM6

Expression Region

1-185

Origin

Picea sitchensis (Sitka spruce) (Pinus sitchensis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTDSNSGHLLQAKRFELLFRVTPLALCIAAMAIMLKNKQSNQYGALHYSDVGGFKYLVY ANGICAIYSILSLLGSVLSTGIDYSWTRAWIMFILDQALTYLILTAGVCGVEIMDLAYQG NEQVSWSRVCVSYGKFCNDARASVLITMAVLVCFMVLSLLSAHRLFSKYEAPIVNNGHHT DFSQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBIS Human Gene Knockout Kit (CRISPR)
KN414795 1 Kit

RBIS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kir2.1 (KCNJ2) Human Gene Knockout Kit (CRISPR)
KN417518 1 Kit

Kir2.1 (KCNJ2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Melperone Hydrochloride
TRC-M216800-50MG 50 mg

Melperone Hydrochloride

Sign In for Pricing
View Details
Vps8 Mouse Gene Knockout Kit (CRISPR)
KN519269 1 Kit

Vps8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD-L1 (CD274) (NM_014143) Human Recombinant Protein
TP700201 20 µg

PD-L1 (CD274) (NM_014143) Human Recombinant Protein

Sign In for Pricing
View Details
Albumin (ALB) (NM_000477) Human Over-expression Lysate
LY424677 100 µg

Albumin (ALB) (NM_000477) Human Over-expression Lysate

Sign In for Pricing
View Details