Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (Lferr_0816)

This Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (Lferr_0816) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

B5ENN2

Expression Region

1-185

Origin

Acidithiobacillus ferrooxidans (strain ATCC 53993) (Leptospirillum ferrooxidans (ATCC 53993) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLLTDFLPIILFFVAYRIHGIYTATEVLIVAAILLMAWQWWRRGRVETMTWVSTLLILT FGGLTLYFHNDTFIKIKPSILYVLFAAALLFTHWREEPLLQRLMGGQLPAALPLSFWRRL NGYWIAFFLFGAVLNLIVAYAFSTGIWVDFKLFGMLAITVIFVLFQAVVISRALPQEAKD GDSSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-500 1x 500 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-100 1x 100 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details