Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ymcC (ymcC)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ymcC (ymcC) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ymcC

UniProt

O31780

Expression Region

1-185

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGIAWMIVFCEIAFWVVIVLGLAVRYVFKRHTLGLLFLALTPVIDLILLAATGVDLYRG ASATAAHGIAAVYIGISIAYGKQMIQWADEKFQYYVTKKGTKPLKRFGMDHAKHGAKGWL RHVLAYLIGAGLLAGMIYFINDSSRTEALSGILKLWTVIIGIDFLITASYFIWPKKEKAS ANLRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2142233-01 0.1 mL

FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2142233-02 0.2 mL

FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2142233-03 0.5 mL

FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2142233-04 1 mL

FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2142233-05 5 mL

FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2142233-06 5x 5 mL

FITC-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details