Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 140 (Tmem140)

This Recombinant Mouse Transmembrane protein 140 (Tmem140) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Transmembrane protein 140

UniProt

Q8BGY5

Expression Region

1-185

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFSRLWRNNHLPFVGIMILLAAALCLMFYALLWKAGNLADLPSLRIGFYNFCLWKEDMG SLACYNFPELDVLGIPQVGLALARLGVYGALVLTVFVPLPLLLAQYNRDEGEWRLAVCFL AASSILLAGGLSLFLSFVWKWLRLSFLGPALPALCLAQLLLIFLLVATVRFPPRDKEDKN QWENC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT11 (NM_004626) Human Over-expression Lysate
LY401465 100 µg

WNT11 (NM_004626) Human Over-expression Lysate

Sign In for Pricing
View Details
Aadacl2fm1 Mouse Gene Knockout Kit (CRISPR)
KN502338 1 Kit

Aadacl2fm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BRCA2 Antibody
8C10682-AAT 50 µg

BRCA2 Antibody

Sign In for Pricing
View Details
ARRDC5 Human Gene Knockout Kit (CRISPR)
KN418570 1 Kit

ARRDC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BST2 Rabbit Polyclonal Antibody
TA392425 100 µL

BST2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NALP4 (NLRP4) (NM_134444) Human Recombinant Protein
TP307991 20 µg

NALP4 (NLRP4) (NM_134444) Human Recombinant Protein

Sign In for Pricing
View Details