Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Prenylated Rab acceptor protein 1 (RABAC1)

This Recombinant Bovine Prenylated Rab acceptor protein 1 (RABAC1) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Prenylated Rab acceptor protein 1, PRA1 family protein 1

UniProt

Q1RMH4

Expression Region

1-185

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVEKDQQKDAEAEGLSAATLLPKLIPSGAGREWLERRRATIRSWGSFVDQRRFSRPRNL GELCQRLVRNVEYYQSNYVFVFLGLILYCVATSPMLLVALAVFFGACYILYLRTLQSKFV LFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEEL QMEPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-100 1x 100 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF640R conjugate, 0.1mg/mL
BNC401526-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8.8), CF488A conjugate, 0.1mg/mL
BNC880689-100 1x 100 µL

Cytokeratin 8 (K8.8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL
BNC681893-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details