Recombinant Pongo abelii Translocon-associated protein subunit gamma (SSR3)
This Recombinant Pongo abelii Translocon-associated protein subunit gamma (SSR3) spans the amino acid sequence from region 1-185.
Product Specifications
Product Name Alternative
Translocon-associated protein subunit gamma, TRAP-gamma, Signal sequence receptor subunit gamma, SSR-gamma
UniProt
Q5RCD7
Expression Region
1-185
Origin
Pongo abelii (Sumatran orangutan)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAPKGSCKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details