Recombinant Dog Prenylated Rab acceptor protein 1 (RABAC1)
This Recombinant Dog Prenylated Rab acceptor protein 1 (RABAC1) spans the amino acid sequence from region 1-185.
Product Specifications
Product Name Alternative
Prenylated Rab acceptor protein 1, PRA1 family protein 1
UniProt
Q8HY39
Expression Region
1-185
Origin
Canis familiaris (Dog) (Canis lupus familiaris)
Field of Research
Neuroscience; Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAAEKDQQKDAEPEGLSATTLLPKLIPSGAGRERLERRRATIRPWSSFVDQRRFSRPRNL GELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKFV LFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVVIGSHAAFHQMEAVDGEEL QMEPV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details