Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Prenylated Rab acceptor protein 1 (Rabac1)

This Recombinant Rat Prenylated Rab acceptor protein 1 (Rabac1) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Prenylated Rab acceptor protein 1, PRA1 family protein 1

UniProt

O35394

Expression Region

1-185

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAQKDQQKDAEVEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNV GELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKLV LFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQIEPADGEEL QMEPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-100 1x 100 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL
BNC400698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF594 conjugate, 0.1mg/mL
BNC942136-500 1x 500 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details