Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays CASP-like protein 12

This Recombinant Zea mays CASP-like protein 12 spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

CASP-like protein 12, Protein salicylic acid-induced 1

UniProt

B6TUW9

Expression Region

1-186

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAAGLKVPEMALRLCVVPLSLASLWEMASNAQADDTYGEVKFSDLSGFSYLVGVNAVTA AYAVASVLASSFKRPLAARYDWVVLVMDQASAYLLVTSASAAAELLQLARHGDRGVSWGE ACSYFGRFCGKATVSLALHAAALACFAALSLVSAFRVFSSRCHPPPDADGQPPKHARDEE QRVYHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC16A1 Polyclonal Antibody
E-AB-53264-01 20 µL

SLC16A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC16A1 Polyclonal Antibody
E-AB-53264-02 60 µL

SLC16A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC16A1 Polyclonal Antibody
E-AB-53264-03 120 µL

SLC16A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC16A1 Polyclonal Antibody
E-AB-53264-04 200 µL

SLC16A1 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703953 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
MAGP1 (MFAP2) Human Gene Knockout Kit (CRISPR)
KN402188 1 Kit

MAGP1 (MFAP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details