Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays CASP-like protein 12

This Recombinant Zea mays CASP-like protein 12 spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

CASP-like protein 12, Protein salicylic acid-induced 1

UniProt

B6TUW9

Expression Region

1-186

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAAGLKVPEMALRLCVVPLSLASLWEMASNAQADDTYGEVKFSDLSGFSYLVGVNAVTA AYAVASVLASSFKRPLAARYDWVVLVMDQASAYLLVTSASAAAELLQLARHGDRGVSWGE ACSYFGRFCGKATVSLALHAAALACFAALSLVSAFRVFSSRCHPPPDADGQPPKHARDEE QRVYHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K15 (NM_001001671) Human Over-expression Lysate
LC400363 20 µg

MAP3K15 (NM_001001671) Human Over-expression Lysate

Sign In for Pricing
View Details
NFE4 (NM_001085386) Human Recombinant Protein
TP320641M 100 µg

NFE4 (NM_001085386) Human Recombinant Protein

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF555 conjugate, 0.1mg/mL
BNC550904-100 1x 100 µL

CD34 (QBEnd/10 + HPCA1/763), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NPPC Antibody
KC-3256-01 50 μL

NPPC Antibody

Sign In for Pricing
View Details
NPPC Antibody
KC-3256-02 100 µL

NPPC Antibody

Sign In for Pricing
View Details
NPPC Antibody
KC-3256-03 1 mL

NPPC Antibody

Sign In for Pricing
View Details