Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max CASP-like protein 2

This Recombinant Glycine max CASP-like protein 2 spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

CASP-like protein 2

UniProt

C6T4A0

Expression Region

1-186

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKAGAVESGEISKGAPPRKGLIRGLSIMDFILRIVAAIATLGSALGMGTTRQTLPFSTQF VKFRAVFSDVPTFVFFVTSNSIVCGYLVLSLVLSFFHIVRSAAVKSRVLQVFLDTVMYGL LTTGASAATAIVYEAHYGNSNTNWFPFCRQYNHFCKQISGSLIGSFIAVVLFIILILMSA ISISKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Polr3g Pre-designed siRNA Set A
SI210832A 1 Each

Rat Polr3g Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-KIAA1468 Polyclonal Antibody
TMAB-08020-01 50 μL

Anti-KIAA1468 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KIAA1468 Polyclonal Antibody
TMAB-08020-02 100 µL

Anti-KIAA1468 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KIAA1468 Polyclonal Antibody
TMAB-08020-03 200 µL

Anti-KIAA1468 Polyclonal Antibody

Sign In for Pricing
View Details
Angiopeptin TFA 10mg
A23225-10 10 mg

Angiopeptin TFA 10mg

Sign In for Pricing
View Details
RBBP6 Antibody, HRP conjugated
A59420-100UG 100 µg

RBBP6 Antibody, HRP conjugated

Sign In for Pricing
View Details